NBR1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant NBR1.
Immunogen
NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag.
Sequence
EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.56 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — NBR1
Entrez GeneID
4077GeneBank Accession#
NM_005899Protein Accession#
NP_005890Gene Name
NBR1
Gene Alias
1A1-3B, KIAA0049, M17S2, MIG19
Gene Description
neighbor of BRCA1 gene 1
Omim ID
166945Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene. [provided by RefSeq
Other Designations
membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125)|migration-inducing protein 19
-
Interactome
-
Disease
-
Publication Reference
-
The role of APC-mediated actin assembly in microtubule capture and focal adhesion turnover.
Juanes MA, Isnardon D, Badache A, Brasselet S, Mavrakis M, Goode BL.
The Journal of Cell Biology 2019 Oct; 218(10):3415.
Application:IP, WB, Human, MDA-MB-231 cells.
-
NBR1 enables autophagy-dependent focal adhesion turnover.
Kenific CM, Stehbens SJ, Goldsmith J, Leidal AM, Faure N, Ye J, Wittmann T, Debnath J.
The Journal of Cell Biology 2016 Feb; 212(5):577.
Application:WB, Human, MCF 10A-Ras cells.
-
p62 and NDP52 target Intracytosolic Shigella and Listeria to different autophagy pathways.
Mostowy S, Sancho-Shimizu V, Hamon M, Simeone R, Brosch R, Johansen T, Cossart P.
The Journal of Biological Chemistry 2011 Jul; 286(30):26987.
Application:IF, WB-Tr, Human, HeLa cells.
-
The role of APC-mediated actin assembly in microtubule capture and focal adhesion turnover.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com