Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NBR1 polyclonal antibody (A01)

  • Catalog # : H00004077-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant NBR1.
  • Immunogen:
  • NBR1 (NP_005890, 2 a.a. ~ 96 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINSQGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPV
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004077-A01
    Western Blot detection against Immunogen (36.56 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4077
  • Gene Name:
  • NBR1
  • Gene Alias:
  • 1A1-3B,KIAA0049,M17S2,MIG19
  • Gene Description:
  • neighbor of BRCA1 gene 1
  • Gene Summary:
  • The protein encoded by this gene was originally identified as an ovarian tumor antigen monitored in ovarian cancer. The encoded protein contains a B-box/coiled coil motif, which is present in many genes with transformation potential, but the function of this protein is unknown. This gene is located on a region of chromosome 17q21.1 that is in close proximity to tumor suppressor gene BRCA1. Three alternatively spliced variants encoding the same protein have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • membrane component, chromosome 17, surface marker 2 (ovarian carcinoma antigen CA125),migration-inducing protein 19
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook