Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

M6PR (Human) Recombinant Protein (Q01)

  • Catalog # : H00004074-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human M6PR partial ORF ( NP_002346, 211 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 33.11
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004074-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4074
  • Gene Name:
  • M6PR
  • Gene Alias:
  • CD-MPR,FLJ32994,MPR46,SMPR
  • Gene Description:
  • mannose-6-phosphate receptor (cation dependent)
  • Gene Summary:
  • The protein encoded by this gene is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane. [provided by RefSeq
  • Other Designations:
  • 46-kDa mannose 6-phosphate receptor,Mr 46,000 Man6PR,cation-dependent mannose-6-phosphate receptor
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook