Product Browser

Last updated: 2016/11/27
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

M6PR polyclonal antibody (A01)

  • Catalog # : H00004074-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant M6PR.
  • Immunogen:
  • M6PR (NP_002346, 211 a.a. ~ 277 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QRLVVGAKGMEQFPHLAFWQDLGNLVADGCDFVCRSKPRNVPAAYRGVGDDQLGEESEERDDHLLPM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004074-A01
    Western Blot detection against Immunogen (33.48 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4074
  • Gene Name:
  • M6PR
  • Gene Alias:
  • CD-MPR,FLJ32994,MPR46,SMPR
  • Gene Description:
  • mannose-6-phosphate receptor (cation dependent)
  • Gene Summary:
  • The protein encoded by this gene is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane. [provided by RefSeq
  • Other Designations:
  • 46-kDa mannose 6-phosphate receptor,Mr 46,000 Man6PR,cation-dependent mannose-6-phosphate receptor
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook