Product Browser

Last updated: 2022/5/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EPCAM DNAxPab DNAxPab

  • Catalog # : H00004072-W02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a partial-length human EPCAM DNA using DNAx™ Immune technology.
  • Immunogen:
  • CALCRL (NP_002345.1, 24 a.a. ~ 245 a.a) partial-length human DNA
  • Sequence:
  • QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Purification:
  • Protein A
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of EPCAM expression in transfected 293T cell line by EPCAM DNAxPab polyclonal antibody.

    Lane 1: EPCAM transfected lysate(47.74 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunofluorescence (Transfected cell)
  • Flow Cytometry (Transfected cell)
  • Gene Information
  • Entrez GeneID:
  • 4072
  • Gene Name:
  • EPCAM
  • Gene Alias:
  • 17-1A,323/A3,CD326,CO-17A,CO17-1A,EGP,EGP-2,EGP34,EGP40,ESA,Ep-CAM,GA733-2,HEA125,KS1/4,KSA,M4S1,MH99,MIC18,MK-1,MOC31,TACST-1,TACSTD1,TROP1,hEGP-2
  • Gene Description:
  • epithelial cell adhesion molecule
  • Gene Summary:
  • This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq
  • Other Designations:
  • adenocarcinoma-associated antigen,carcinoma-associated antigen GA733-2,human epithelial glycoprotein-2,membrane component, chromosome 4, surface marker (35kD glycoprotein),tumor-associated calcium signal transducer 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook