Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EPCAM (Human) Recombinant ProteinHuPro Protein

  • Catalog # : H00004072-H01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Purified EPCAM (NP_002345.1 24 a.a. - 265 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293T cells
  • Sequence:
  • QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 31.9
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-EPCAM plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • ≥ 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE and Western Blot
    SDS-PAGE Gel
    QC Testing of H00004072-H01

    Western Blot
    QC Testing of H00004072-H01
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 4072
  • Gene Name:
  • EPCAM
  • Gene Alias:
  • 17-1A,323/A3,CD326,CO-17A,CO17-1A,EGP,EGP-2,EGP34,EGP40,ESA,Ep-CAM,GA733-2,HEA125,KS1/4,KSA,M4S1,MH99,MIC18,MK-1,MOC31,TACST-1,TACSTD1,TROP1,hEGP-2
  • Gene Description:
  • epithelial cell adhesion molecule
  • Gene Summary:
  • This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq
  • Other Designations:
  • adenocarcinoma-associated antigen,carcinoma-associated antigen GA733-2,human epithelial glycoprotein-2,membrane component, chromosome 4, surface marker (35kD glycoprotein),tumor-associated calcium signal transducer 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook