Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TACSTD2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004070-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TACSTD2 partial ORF ( NP_002344, 31 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004070-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4070
  • Gene Name:
  • TACSTD2
  • Gene Alias:
  • EGP-1,GA733,GA733-1,M1S1,TROP2
  • Gene Description:
  • tumor-associated calcium signal transducer 2
  • Gene Summary:
  • This intronless gene encodes a carcinoma-associated antigen defined by the monoclonal antibody GA733. This antigen is a member of a family including at least two type I membrane proteins. It transduces an intracellular calcium signal and acts as a cell surface receptor. Mutations of this gene result in gelatinous drop-like corneal dystrophy, an autosomal recessive disorder characterized by severe corneal amyloidosis leading to blindness. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000011755,epithelial glycoprotein-1,membrane component, chromosome 1, surface marker 1 (40kD glycoprotein, identified by monoclonal antibody GA733)
  • RSS
  • YouTube
  • Linkedin
  • Facebook