Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SH2D1A (Human) Recombinant Protein (P01)

  • Catalog # : H00004068-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human SH2D1A full-length ORF ( AAH20732, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 39.82
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004068-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4068
  • Gene Name:
  • SH2D1A
  • Gene Alias:
  • DSHP,EBVS,FLJ18687,FLJ92177,IMD5,LYP,MTCP1,SAP,XLP,XLPD
  • Gene Description:
  • SH2 domain protein 1A
  • Gene Summary:
  • This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Duncan's disease,OTTHUMP00000023976,SLAM-associated protein,T cell signal transduction molecule SAP,signaling lymphocyte activation molecule-associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook