Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SH2D1A MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00004068-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human SH2D1A protein.
  • Immunogen:
  • SH2D1A (NP_002342, 1 a.a. ~ 128 a.a) full-length human protein.
  • Sequence:
  • MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of SH2D1A expression in transfected 293T cell line (H00004068-T01) by SH2D1A MaxPab polyclonal antibody.

    Lane 1: SH2D1A transfected lysate(14.08 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4068
  • Gene Name:
  • SH2D1A
  • Gene Alias:
  • DSHP,EBVS,FLJ18687,FLJ92177,IMD5,LYP,MTCP1,SAP,XLP,XLPD
  • Gene Description:
  • SH2 domain protein 1A
  • Gene Summary:
  • This gene encodes a protein that plays a major role in the bidirectional stimulation of T and B cells. This protein contains an SH2 domain and a short tail. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in this gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Duncan's disease,OTTHUMP00000023976,SLAM-associated protein,T cell signal transduction molecule SAP,signaling lymphocyte activation molecule-associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook