Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LY9 polyclonal antibody (A01)

  • Catalog # : H00004063-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LY9.
  • Immunogen:
  • LY9 (NP_002339, 156 a.a. ~ 253 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPREPHASESNGGSILTVSRTPCDPDLPYICTAQNPVSQRSSLPVHVGQFCTDPGASRGGTT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004063-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4063
  • Gene Name:
  • LY9
  • Gene Alias:
  • CD229,SLAMF3,hly9,mLY9
  • Gene Description:
  • lymphocyte antigen 9
  • Gene Summary:
  • LY9 belongs to the SLAM family of immunomodulatory receptors (see SLAMF1; MIM 603492) and interacts with the adaptor molecule SAP (SH2D1A; MIM 300490) (Graham et al., 2006 [PubMed 16365421]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000025675,T-lymphocyte surface antigen Ly-9,cell-surface molecule Ly-9
  • RSS
  • YouTube
  • Linkedin
  • Facebook