LUM (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human LUM full-length ORF ( NP_002336.1, 1 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
64.8
Interspecies Antigen Sequence
Mouse (87); Rat (85)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — LUM
Entrez GeneID
4060GeneBank Accession#
NM_002345.3Protein Accession#
NP_002336.1Gene Name
LUM
Gene Alias
LDC, SLRR2D
Gene Description
lumican
Omim ID
600616Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. [provided by RefSeq
Other Designations
lumican proteoglycan
-
Interactome
-
Disease
-
Publication Reference
-
Fibrinogen, riboflavin, and UVA to immobilize a corneal flap--molecular mechanisms.
Littlechild SL, Zhang Y, Tomich JM, Conrad GW.
Investigative Ophthalmology & Visual Science 2012 Sep; 53(10):5991.
Application：Func, Rabbit, Immobilized corneal macromolecules.
-
Effects of Ultraviolet-A and Riboflavin on the Interaction of Collagen and Proteoglycans during Corneal Cross-linking.
Zhang Y, Conrad AH, Conrad GW.
The Journal of Biological Chemistry 2011 Apr; 286(15):13011.
Application：PI, WB-Re, Recombinant protein.
-
Fibrinogen, riboflavin, and UVA to immobilize a corneal flap--molecular mechanisms.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com