LUM purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human LUM protein.
Immunogen
LUM (NP_002336.1, 1 a.a. ~ 338 a.a) full-length human protein.
Sequence
MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LUM expression in transfected 293T cell line (H00004060-T02) by LUM MaxPab polyclonal antibody.
Lane 1: LUM transfected lysate(38.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — LUM
Entrez GeneID
4060GeneBank Accession#
NM_002345Protein Accession#
NP_002336.1Gene Name
LUM
Gene Alias
LDC, SLRR2D
Gene Description
lumican
Omim ID
600616Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the small leucine-rich proteoglycan (SLRP) family that includes decorin, biglycan, fibromodulin, keratocan, epiphycan, and osteoglycin. In these bifunctional molecules, the protein moiety binds collagen fibrils and the highly charged hydrophilic glycosaminoglycans regulate interfibrillar spacings. Lumican is the major keratan sulfate proteoglycan of the cornea but is also distributed in interstitial collagenous matrices throughout the body. Lumican may regulate collagen fibril organization and circumferential growth, corneal transparency, and epithelial cell migration and tissue repair. [provided by RefSeq
Other Designations
lumican proteoglycan
-
Interactome
-
Disease
-
Publication Reference
-
Changes in glycosaminoglycan structure on differentiation of human embryonic stem cells towards mesoderm and endoderm lineages.
Gasimli L, Hickey AM, Yang B, Li G, dela Rosa M, Nairn AV, Kulik MJ, Dordick JS, Moremen KW, Dalton S, Linhardt RJ.
Biochimica et Biophysica Acta 2014 Jun; 1840(6):1993.
Application:WB, Human, hESC H9 cells.
-
Structural remodeling of proteoglycans upon retinoic acid-induced differentiation of NCCIT cells.
Gasimli L, Stansfield HE, Nairn AV, Liu H, Paluh JL, Yang B, Dordick JS, Moremen KW, Linhardt RJ.
Glycoconjugate Journal 2013 Jul; 30(5):497.
Application:WB-Ce, Human, NCCIT cells.
-
Changes in glycosaminoglycan structure on differentiation of human embryonic stem cells towards mesoderm and endoderm lineages.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com