BCAM (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human BCAM partial ORF ( NP_005572, 32 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGA
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.74
Interspecies Antigen Sequence
Mouse (65); Rat (67)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — BCAM
Entrez GeneID
4059GeneBank Accession#
NM_005581Protein Accession#
NP_005572Gene Name
BCAM
Gene Alias
AU, CD239, LU, MSK19
Gene Description
basal cell adhesion molecule (Lutheran blood group)
Omim ID
111200Gene Ontology
HyperlinkGene Summary
Lutheran blood group glycoprotein is a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five, N-terminus, extracellular immunoglobulin domains, a single transmembrane domain, and a short, C-terminal cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
Auberger b antigen|B-CAM cell surface glycoprotein|B-cell adhesion molecule|F8/G253 antigen|Lutheran blood group (Auberger b antigen included)|antigen identified by monoclonal antibody F8|basal cell adhesion molecule|basal cell adhesion molecule (Lu and A
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com