Product Browser

Last updated: 2017/1/15
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BCAM polyclonal antibody (A01)

  • Catalog # : H00004059-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant BCAM.
  • Immunogen:
  • BCAM (NP_005572, 32 a.a. ~ 131 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EVRLSVPPLVEVMRGKSVILDCTPTGTHDHYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDERDYVCVVRAGA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004059-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • BCAM polyclonal antibody (A01), Lot # 050921JC01 Western Blot analysis of BCAM expression in HepG2 ( Cat # L019V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4059
  • Gene Name:
  • BCAM
  • Gene Alias:
  • AU,CD239,LU,MSK19
  • Gene Description:
  • basal cell adhesion molecule (Lutheran blood group)
  • Gene Summary:
  • Lutheran blood group glycoprotein is a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five, N-terminus, extracellular immunoglobulin domains, a single transmembrane domain, and a short, C-terminal cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • Auberger b antigen,B-CAM cell surface glycoprotein,B-cell adhesion molecule,F8/G253 antigen,Lutheran blood group (Auberger b antigen included),antigen identified by monoclonal antibody F8,basal cell adhesion molecule,basal cell adhesion molecule (Lu and A
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook