Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CYP4F3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004051-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CYP4F3 partial ORF ( NP_000887, 100 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLM
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004051-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4051
  • Gene Name:
  • CYP4F3
  • Gene Alias:
  • CPF3,CYP4F,LTB4H
  • Gene Description:
  • cytochrome P450, family 4, subfamily F, polypeptide 3
  • Gene Summary:
  • This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading leukotriene B4, a potent mediator of inflammation. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F8, is approximately 18 kb away. [provided by RefSeq
  • Other Designations:
  • cytochrome P-450,cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omega hydroxylase),cytochrome P450-LTB-omega,leukotriene B4 omega hydroxylase,leukotriene-B4 20-monooxygenase
  • RSS
  • YouTube
  • Linkedin
  • Facebook