CYP4F3 monoclonal antibody (M01), clone 4E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CYP4F3 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CYP4F3.
Immunogen
CYP4F3 (NP_000887, 100 a.a. ~ 198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (72)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CYP4F3 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — CYP4F3
Entrez GeneID
4051GeneBank Accession#
NM_000896Protein Accession#
NP_000887Gene Name
CYP4F3
Gene Alias
CPF3, CYP4F, LTB4H
Gene Description
cytochrome P450, family 4, subfamily F, polypeptide 3
Omim ID
601270Gene Ontology
HyperlinkGene Summary
This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading leukotriene B4, a potent mediator of inflammation. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F8, is approximately 18 kb away. [provided by RefSeq
Other Designations
cytochrome P-450|cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omega hydroxylase)|cytochrome P450-LTB-omega|leukotriene B4 omega hydroxylase|leukotriene-B4 20-monooxygenase
-
Interactome
-
Pathway
-
Publication Reference
-
Detection of EETs and HETEs-generating Cytochrome P450 Enzymes and the Effects of their Metabolites on Myometrial and Vascular Function.
Pearson T, Warren AY, Barrett DA, Khan RN.
American Journal of Physiology. Endocrinology and Metabolism 2009 Sep; 297(3):E647.
Application：WB, IF, Human, Myometrial tissue.
-
Detection of EETs and HETEs-generating Cytochrome P450 Enzymes and the Effects of their Metabolites on Myometrial and Vascular Function.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com