CYP4F3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CYP4F3 polyclonal antibody (A01), Lot # UNO2060310QCS1 Western Blot analysis of CYP4F3 expression in NIH/3T3 ( Cat # L018V1 ).
Western Blot detection against Immunogen (37 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CYP4F3.
Immunogen
CYP4F3 (NP_000887, 100 a.a. ~ 198 a.a) partial recombinant protein with GST tag.
Sequence
RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLM
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (73); Rat (72)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CYP4F3 polyclonal antibody (A01), Lot # UNO2060310QCS1 Western Blot analysis of CYP4F3 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — CYP4F3
Entrez GeneID
4051GeneBank Accession#
NM_000896Protein Accession#
NP_000887Gene Name
CYP4F3
Gene Alias
CPF3, CYP4F, LTB4H
Gene Description
cytochrome P450, family 4, subfamily F, polypeptide 3
Omim ID
601270Gene Ontology
HyperlinkGene Summary
This gene, CYP4F3, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. The enzyme starts the process of inactivating and degrading leukotriene B4, a potent mediator of inflammation. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Another member of this family, CYP4F8, is approximately 18 kb away. [provided by RefSeq
Other Designations
cytochrome P-450|cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omega hydroxylase)|cytochrome P450-LTB-omega|leukotriene B4 omega hydroxylase|leukotriene-B4 20-monooxygenase
-
Interactome
-
Pathway
-
Publication Reference
-
Immunochemical quantification of cynomolgus CYP2J2, CYP4A and CYP4F enzymes in liver and small intestine.
Uehara S, Murayama N, Nakanishi Y, Nakamura C, Hashizume T, Zeldin DC, Yamazaki H, Uno Y.
Xenobiotica 2015 Feb; 45(2):124.
Application：WB-Ti, Monkey, Liver, Small intestine.
-
Comparison of toxicity of benzene metabolite hydroquinone in hematopoietic stem cells derived from murine embryonic yolk sac and adult bone marrow.
Zhu J, Wang H, Yang S, Guo L, Li Z, Wang W, Wang S, Huang W, Wang L, Yang T, Ma Q, Bi Y.
PLoS One 2013 Aug; 8(8):e71153.
Application：WB-Ce, Mouse, BM-HSC, YS-HSC cells.
-
Induction of CYP4F3 by benzene metabolites in human white blood cells in vivo, in human promyelocytic leukemic cell lines, and ex vivo in human blood neutrophils.
Zhao Z, He X, Bi Y, Xia Y, Tao N, Li L, Ma Q.
Drug Metabolism and Disposition 2008 Nov; 37(2):282.
Application：Flow Cyt, WB, Human, Human blood neutrophils, HL-60, K562 cells.
-
Immunochemical quantification of cynomolgus CYP2J2, CYP4A and CYP4F enzymes in liver and small intestine.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com