Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LTA (Human) Recombinant Protein (P01)

  • Catalog # : H00004049-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LTA full-length ORF ( AAH34729, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MTPPERLFLPRVRGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48.29
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004049-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4049
  • Gene Name:
  • LTA
  • Gene Alias:
  • LT,TNFB,TNFSF1
  • Gene Description:
  • lymphotoxin alpha (TNF superfamily, member 1)
  • Gene Summary:
  • The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4 and psoriatic arthritis
  • Other Designations:
  • OTTHUMP00000029184,OTTHUMP00000037612,OTTHUMP00000037613,OTTHUMP00000165897,lymphotoxin alpha,tumor necrosis factor beta
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook