Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LTA monoclonal antibody (M21), clone 2B7

  • Catalog # : H00004049-M21
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant LTA.
  • Immunogen:
  • Recombinant Flag/His fusion protein corresponding to amino acids 58-205 of human LTA.
  • Sequence:
  • HSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Conjugation:
  • Flag/His
  • Isotype:
  • IgG1, kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00004049-M21
    Western Blot detection against Immunogen (19.69 KDa) .
  • Recommend Usage:
  • The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 4049
  • Gene Name:
  • LTA
  • Gene Alias:
  • LT,TNFB,TNFSF1
  • Gene Description:
  • lymphotoxin alpha (TNF superfamily, member 1)
  • Gene Summary:
  • The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4 and psoriatic arthritis
  • Other Designations:
  • OTTHUMP00000029184,OTTHUMP00000037612,OTTHUMP00000037613,OTTHUMP00000165897,lymphotoxin alpha,tumor necrosis factor beta
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook