Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LTA purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00004049-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human LTA protein.
  • Immunogen:
  • LTA (AAH34729.1, 1 a.a. ~ 205 a.a) full-length human protein.
  • Sequence:
  • MTPPERLFLPRVRGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of LTA expression in transfected 293T cell line (H00004049-T01) by LTA MaxPab polyclonal antibody.

    Lane 1: LTA transfected lysate(22.30 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4049
  • Gene Name:
  • LTA
  • Gene Alias:
  • LT,TNFB,TNFSF1
  • Gene Description:
  • lymphotoxin alpha (TNF superfamily, member 1)
  • Gene Summary:
  • The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4 and psoriatic arthritis
  • Other Designations:
  • OTTHUMP00000029184,OTTHUMP00000037612,OTTHUMP00000037613,OTTHUMP00000165897,lymphotoxin alpha,tumor necrosis factor beta
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook