Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LSP1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00004046-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LSP1 partial ORF ( NP_002330.1, 240 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00004046-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 4046
  • Gene Name:
  • LSP1
  • Gene Alias:
  • WP34,pp52
  • Gene Description:
  • lymphocyte-specific protein 1
  • Gene Summary:
  • This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
  • Other Designations:
  • 47 kDa actin binding protein,52 kDa phosphoprotein,F-actin binding and cytoskeleton associated protein,OTTHUMP00000014139,OTTHUMP00000069612,leufactin (leukocyte F-actin binding protein),leukocyte-specific protein 1,lymphocyte-specific antigen WP34,lympho
  • RSS
  • YouTube
  • Linkedin
  • Facebook