LSP1 monoclonal antibody (M07), clone 1C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of LSP1 expression in transfected 293T cell line by LSP1 monoclonal antibody (M07), clone 1C4.
Lane 1: LSP1 transfected lysate(37.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LSP1 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LSP1.
Immunogen
LSP1 (NP_002330.1, 240 a.a. ~ 338 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TAGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQKGGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (88)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LSP1 expression in transfected 293T cell line by LSP1 monoclonal antibody (M07), clone 1C4.
Lane 1: LSP1 transfected lysate(37.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LSP1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — LSP1
Entrez GeneID
4046GeneBank Accession#
NM_002339Protein Accession#
NP_002330.1Gene Name
LSP1
Gene Alias
WP34, pp52
Gene Description
lymphocyte-specific protein 1
Omim ID
153432Gene Ontology
HyperlinkGene Summary
This gene encodes an intracellular F-actin binding protein. The protein is expressed in lymphocytes, neutrophils, macrophages, and endothelium and may regulate neutrophil motility, adhesion to fibrinogen matrix proteins, and transendothelial migration. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
47 kDa actin binding protein|52 kDa phosphoprotein|F-actin binding and cytoskeleton associated protein|OTTHUMP00000014139|OTTHUMP00000069612|leufactin (leukocyte F-actin binding protein)|leukocyte-specific protein 1|lymphocyte-specific antigen WP34|lympho
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com