Product Browser

Last updated: 2017/7/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LRP1 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00004035-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human LRP1 protein.
  • Immunogen:
  • LRP1 (AAH45107.1, 1 a.a. ~ 292 a.a) full-length human protein.
  • Sequence:
  • MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of LRP1 expression in transfected 293T cell line (H00004035-T01) by LRP1 MaxPab polyclonal antibody.

    Lane 1: LRP1 transfected lysate(32.12 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) enlargeenlarge this image
  • Immunoperoxidase of purified MaxPab antibody to LRP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 4035
  • Gene Name:
  • LRP1
  • Gene Alias:
  • A2MR,APOER,APR,CD91,FLJ16451,IGFBP3R,LRP,MGC88725,TGFBR5
  • Gene Description:
  • low density lipoprotein-related protein 1 (alpha-2-macroglobulin receptor)
  • Other Designations:
  • TbetaR-V/LRP-1/IGFBP-3 receptor,alpha-2-macroglobulin receptor,low density lipoprotein-related protein 1,type V tgf-beta receptor
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook