LOXL2 monoclonal antibody (M01), clone 5D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LOXL2.
Immunogen
LOXL2 (NP_002309, 675 a.a. ~ 773 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LOXL2 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — LOXL2
Entrez GeneID
4017GeneBank Accession#
NM_002318Protein Accession#
NP_002309Gene Name
LOXL2
Gene Alias
LOR2, WS9-14
Gene Description
lysyl oxidase-like 2
Omim ID
606663Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq
Other Designations
lysyl oxidase homolog 2|lysyl oxidase related 2
-
Interactome
-
Disease
-
Publication Reference
-
Scavenger Receptor Cysteine-Rich domains of Lysyl Oxidase-Like2 regulate endothelial ECM and angiogenesis through non-catalytic scaffolding mechanisms.
Umana-Diaz C, Pichol-Thievend C, Marchand MF, Atlas Y, Salza R, Malbouyres M, Barret A, Teillon J, Ardidie-Robouant C, Ruggiero F, Monnot C, Girard P, Guilluy C, Ricard-Blum S, Germain S, Muller L.
Matrix Biology 2020 Jun; 88:33.
Application:WB-Ce, WB-Tr, Fish, Human, Mouse, CHO cells, HUVECs, Zebrafish embryos.
-
Lysyl oxidase-like 2 (LOXL2)-mediated cross-linking of tropoelastin.
Schmelzer CEH, Heinz A, Troilo H, Lockhart-Cairns MP, Jowitt TA, Marchand MF, Bidault L, Bignon M, Hedtke T, Barret A, McConnell JC, Sherratt MJ, Germain S, Hulmes DJS, Baldock C, Muller L.
FASEB Journal 2019 Apr; 33(4):5468.
Application:IF, WB-Ti, Mouse, Tibialis anterior, Aorta.
-
A three-gene signature from protein-protein interaction network of LOXL2- and actin-related proteins for esophageal squamous cell carcinoma prognosis.
Zhan XH, Jiao JW, Zhang HF, Li CQ, Zhao JM, Liao LD, Wu JY, Wu BL, Wu ZY, Wang SH, Du ZP, Shen JH, Zou HY, Neufeld G, Xu LY, Li EM.
Cancer Medicine 2017 May; 6(7):1707.
Application:IHC, Human, Human esophageal squamous cell carcinoma (ESCC).
-
Reduced nuclear and ectopic cytoplasmic expression of lysyl oxidase-like 2 is associated with lymph node metastasis and poor prognosis in esophageal squamous cell carcinoma.
Li TY, Xu LY, Wu ZY, Liao LD, Shen JH, Xu XE, Du ZP, Zhao Q, Li EM.
Human Pathology 2011 Dec; 43(7):1068.
Application:IHC, Human, Esophageal squamous cell carcinoma.
-
Epithelial-Mesenchymal Transition Induced by Hepatitis C Virus Core Protein in Cholangiocarcinoma.
Li T, Li D, Cheng L, Wu H, Gao Z, Liu Z, Jiang W, Gao YH, Tian F, Zhao L, Wang S.
Annals of Surgical Oncology 2010 Jul; 17(7):1937.
Application:WB-Tr, Human, QBC939 cells.
-
Reciprocal regulation of LOX and LOXL2 expression during cell adhesion and terminal differentiation in epidermal keratinocytes.
Fujimoto E, Tajima S.
Journal of Dermatological Science 2009 Aug; 55(2):91.
Application:IF, Human, Human keratinocytes.
-
Scavenger Receptor Cysteine-Rich domains of Lysyl Oxidase-Like2 regulate endothelial ECM and angiogenesis through non-catalytic scaffolding mechanisms.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com