Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FADS3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003995-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FADS3 partial ORF ( NP_068373, 16 a.a. - 113 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.52
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003995-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3995
  • Gene Name:
  • FADS3
  • Gene Alias:
  • CYB5RP,LLCDL3
  • Gene Description:
  • fatty acid desaturase 3
  • Gene Summary:
  • The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq
  • Other Designations:
  • delta-9 fatty acid desaturase,delta-9-desaturase,linoleoyl-CoA desaturase (delta-9-desaturase)-like 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook