FADS3 monoclonal antibody (M07), clone 3D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FADS3 monoclonal antibody (M07), clone 3D2. Western Blot analysis of FADS3 expression in human placenta.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FADS3 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FADS3.
Immunogen
FADS3 (NP_068373, 16 a.a. ~ 113 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FADS3 monoclonal antibody (M07), clone 3D2. Western Blot analysis of FADS3 expression in human placenta.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FADS3 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — FADS3
Entrez GeneID
3995GeneBank Accession#
NM_021727Protein Accession#
NP_068373Gene Name
FADS3
Gene Alias
CYB5RP, LLCDL3
Gene Description
fatty acid desaturase 3
Omim ID
606150Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq
Other Designations
delta-9 fatty acid desaturase|delta-9-desaturase|linoleoyl-CoA desaturase (delta-9-desaturase)-like 3
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com