LLGL2 monoclonal antibody (M06), clone 4G2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LLGL2.
Immunogen
LLGL2 (NP_004515, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSDAVLQRLPEEARHRRVFEMVEALQEHPR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LLGL2 expression in transfected 293T cell line by LLGL2 monoclonal antibody (M06), clone 4G2.
Lane 1: LLGL2 transfected lysate(113 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to LLGL2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LLGL2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — LLGL2
Entrez GeneID
3993GeneBank Accession#
NM_004524Protein Accession#
NP_004515Gene Name
LLGL2
Gene Alias
HGL, LGL2
Gene Description
lethal giant larvae homolog 2 (Drosophila)
Gene Ontology
HyperlinkGene Summary
The lethal (2) giant larvae protein of Drosophila plays a role in asymmetric cell division, epithelial cell polarity, and cell migration. This human gene encodes a protein similar to lethal (2) giant larvae of Drosophila. In fly, the protein's ability to localize cell fate determinants is regulated by the atypical protein kinase C (aPKC). In human, this protein interacts with aPKC-containing complexes and is cortically localized in mitotic cells. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
human giant larvae homolog|lethal giant larvae homolog 2
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Co-expression effect of LLGL2 and SLC7A5 to predict prognosis in ERα-positive breast cancer.
Tomoka Hisada, Naoto Kondo, Yumi Wanifuchi-Endo, Satoshi Osaga, Takashi Fujita, Tomoko Asano, Yasuaki Uemoto, Sayaka Nishikawa, Yusuke Katagiri, Mitsuo Terada, Akiko Kato, Hiroshi Sugiura, Katsuhiro Okuda, Hiroyuki Kato, Masayuki Komura, Satoshi Morita, Satoru Takahashi, Tatsuya Toyama.
Scientific Reports 2022 Oct; 12(1):16515.
Application:IF, Human, Numan breast cancer.
-
A conserved polybasic domain mediates plasma membrane targeting of Lgl and its regulation by hypoxia.
Dong W, Zhang X, Liu W, Chen YJ, Huang J, Austin E, Celotto AM, Jiang WZ, Palladino MJ, Jiang Y, Hammond GR, Hong Y.
The Journal of Cell Biology 2015 Oct; 211(2):273.
Application:IF, Drosophila, Ovary.
-
Distinguishing Barrett gastric foveolar dysplasia from reactive cardiac mucosa in gastroesophageal reflux disease.
Patil DT, Bennett AE, Mahajan D, Bronner MP.
Human Pathology 2013 Jan; 44(6):1146.
Application:IHC, Human, Gastric cardiac mucosa, Barrett gastric foveolar dysplasia .
-
Hugl1 and Hugl2 in mammary epithelial cells: polarity, proliferation, and differentiation.
Russ A, Louderbough JM, Zarnescu D, Schroeder JA.
PLoS One 2012 Oct; 7(10):e47734.
Application:IF, IHC-P, WB-Tr, Human, Breast ductal epithelium, Mammary tissues, HMECs, MCF10A, MDA-MB-453 cells.
-
Loss of Scribble causes cell competition in mammalian cells.
Norman M, Wisniewska KA, Lawrenson K, Garcia-Miranda P, Tada M, Kajita M, Mano H, Ishikawa S, Ikegawa M, Shimada T, Fujita Y.
Journal of Cell Science 2012 Jan; 125(Pt1):59.
Application:WB-Ce, Dog, MDCK.
-
Involvement of Lgl and Mahjong/VprBP in cell competition.
Tamori Y, Bialucha CU, Tian AG, Kajita M, Huang YC, Norman M, Harrison N, Poulton J, Ivanovitch K, Disch L, Liu T, Deng WM, Fujita Y.
PLoS Biology 2010 Jul; 8(7):e1000422.
Application:WB-Tr, Dog, MDCK cells.
-
ASPP2 Regulates Epithelial Cell Polarity through the PAR Complex.
Cong W, Hirose T, Harita Y, Yamashita A, Mizuno K, Hirano H, Ohno S.
Current Biology 2010 Aug; 20(15):1408.
Application:WB-Tr, Dog, MDCK cells.
-
Co-expression effect of LLGL2 and SLC7A5 to predict prognosis in ERα-positive breast cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com