FADS1 monoclonal antibody (M04), clone 2D9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FADS1.
Immunogen
FADS1 (NP_037534, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (82)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
monoclonal antibody (M04), clone 2D9. Western Blot analysis of expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FADS1 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FADS1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — FADS1
Entrez GeneID
3992GeneBank Accession#
NM_013402Protein Accession#
NP_037534Gene Name
FADS1
Gene Alias
D5D, FADS6, FADSD5, FLJ38956, FLJ90273, LLCDL1, TU12
Gene Description
fatty acid desaturase 1
Omim ID
606148Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq
Other Designations
delta(5) desaturase|delta-5 desaturase|delta-5 fatty acid desaturase|linoleoyl-CoA desaturase (delta-6-desaturase)-like 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com