LIMK1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
LIMK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of LIMK1 expression in mouse brain.
Western Blot (Transfected lysate)
Western Blot analysis of LIMK1 expression in transfected 293T cell line (H00003984-T01) by LIMK1 MaxPab polyclonal antibody.
Lane 1: LIMK1 transfected lysate(71.17 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to LIMK1 on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human LIMK1 protein.
Immunogen
LIMK1 (AAI52983.1, 1 a.a. ~ 647 a.a) full-length human protein.
Sequence
MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPD
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
LIMK1 MaxPab rabbit polyclonal antibody. Western Blot analysis of LIMK1 expression in mouse brain.Western Blot (Transfected lysate)
Western Blot analysis of LIMK1 expression in transfected 293T cell line (H00003984-T01) by LIMK1 MaxPab polyclonal antibody.
Lane 1: LIMK1 transfected lysate(71.17 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to LIMK1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — LIMK1
Entrez GeneID
3984GeneBank Accession#
BC152982Protein Accession#
AAI52983.1Gene Name
LIMK1
Gene Alias
LIMK
Gene Description
LIM domain kinase 1
Omim ID
601329Gene Ontology
HyperlinkGene Summary
There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome. [provided by RefSeq
Other Designations
LIM motif-containing protein kinase|OTTHUMP00000025066
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com