ABLIM1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ABLIM1 full-length ORF ( AAH02448.1, 1 a.a. - 401 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRAKVDNEILDYKDLAAIPKVKAIYDIERPDLITYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINSPVYSRHSYTPTTSRSPQHFHRPDQGINIYRKPPIYKQHAALAAQSKSSEDIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASHIPSSKTASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRDYQTLPDGHMPAMRMDRGVSMPNMLEPKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
72.5
Interspecies Antigen Sequence
Mouse (90)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ABLIM1
Entrez GeneID
3983GeneBank Accession#
BC002448.2Protein Accession#
AAH02448.1Gene Name
ABLIM1
Gene Alias
ABLIM, DKFZp781D0148, FLJ14564, KIAA0059, LIMAB1, LIMATIN, MGC1224
Gene Description
actin binding LIM protein 1
Omim ID
602330Gene Ontology
HyperlinkGene Summary
This gene encodes a cytoskeletal LIM protein that binds to actin filaments via a domain that is homologous to erythrocyte dematin. LIM domains, found in over 60 proteins, play key roles in the regulation of developmental pathways. LIM domains also function as protein-binding interfaces, mediating specific protein-protein interactions. The protein encoded by this gene could mediate such interactions between actin filaments and cytoplasmic targets. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
LIM actin-binding protein 1|OTTHUMP00000020530|OTTHUMP00000020531|OTTHUMP00000020536|actin-binding LIM protein 1|actin-binding double-zinc-finger protein
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
ABLIM1, a novel ubiquitin E3 ligase, promotes growth and metastasis of colorectal cancer through targeting IĸBα ubiquitination and activating NF-ĸB signaling.
Ying He, Qian Shi, Yuhang Ling, Huihui Guo, Yi Fei, Ruoyu Wu, Chengwu Tang, Xilin Zhang, Linhua Yao.
Cell Death and Differentiation 2024 Feb; 31(2):203.
Application:Autoubiquitination assay, Human, HCT16 cell line.
-
ABLIM1, a novel ubiquitin E3 ligase, promotes growth and metastasis of colorectal cancer through targeting IĸBα ubiquitination and activating NF-ĸB signaling.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com