Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LIF purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00003976-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human LIF protein.
  • Immunogen:
  • LIF (NP_002300.1, 1 a.a. ~ 202 a.a) full-length human protein.
  • Sequence:
  • MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of LIF expression in transfected 293T cell line (H00003976-T01) by LIF MaxPab polyclonal antibody.

    Lane 1: LIF transfected lysate(22.22 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3976
  • Gene Name:
  • LIF
  • Gene Alias:
  • CDF,DIA,HILDA
  • Gene Description:
  • leukemia inhibitory factor (cholinergic differentiation factor)
  • Gene Summary:
  • The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. [provided by RefSeq
  • Other Designations:
  • D factor,cholinergic differentiation factor,differentiation inhibitory activity,differentiation stimulating factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook