LGALS9 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human LGALS9 partial ORF ( NP_033665, 254 a.a. - 355 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
FHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.96
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — LGALS9
Entrez GeneID
3965GeneBank Accession#
NM_009587Protein Accession#
NP_033665Gene Name
LGALS9
Gene Alias
HUAT, LGALS9A, MGC117375, MGC125973, MGC125974
Gene Description
lectin, galactoside-binding, soluble, 9
Omim ID
601879Gene Ontology
HyperlinkGene Summary
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
ecalectin|galectin 9|galectin-9|urate transporter/channel protein
-
Interactome
-
Publication Reference
-
Tim-2 up-regulation and galectin-9-Tim-3 pathway activation in Th2-biased response in Schistosoma japonicum infection in mice.
i Y, Song XR, Shen JL, Xu YH, Shen Q, Luo QL, Zhong ZR, Wang W, Chu DY, Song WJ.
Immunology Letters 2012 May; 144(1-2):60.
Application：Func, Mouse, Spleen lymphocytes.
-
Tim-2 up-regulation and galectin-9-Tim-3 pathway activation in Th2-biased response in Schistosoma japonicum infection in mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com