LGALS8 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human LGALS8 partial ORF ( NP_006490.3, 262 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
AGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.52
Interspecies Antigen Sequence
Mouse (86); Rat (87)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — LGALS8
Entrez GeneID
3964GeneBank Accession#
NM_006499Protein Accession#
NP_006490.3Gene Name
LGALS8
Gene Alias
Gal-8, PCTA-1, PCTA1, Po66-CBP
Gene Description
lectin, galactoside-binding, soluble, 8
Omim ID
606099Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000037854|Po66 carbohydrate binding protein|galectin 8|galectin-8|galectin-8g|prostate carcinoma tumor antigen 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com