LGALS8 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of LGALS8 expression in transfected 293T cell line (H00003964-T01) by LGALS8 MaxPab polyclonal antibody.
Lane 1: LGALS8 transfected lysate(34.87 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human LGALS8 protein.
Immunogen
LGALS8 (NP_963837.1, 1 a.a. ~ 317 a.a) full-length human protein.
Sequence
MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (80); Rat (81)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LGALS8 expression in transfected 293T cell line (H00003964-T01) by LGALS8 MaxPab polyclonal antibody.
Lane 1: LGALS8 transfected lysate(34.87 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — LGALS8
Entrez GeneID
3964GeneBank Accession#
NM_201543.1Protein Accession#
NP_963837.1Gene Name
LGALS8
Gene Alias
Gal-8, PCTA-1, PCTA1, Po66-CBP
Gene Description
lectin, galactoside-binding, soluble, 8
Omim ID
606099Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000037854|Po66 carbohydrate binding protein|galectin 8|galectin-8|galectin-8g|prostate carcinoma tumor antigen 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com