Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Disease

  • By Biomarker

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LGALS3 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00003958-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human LGALS3 protein.
  • Immunogen:
  • LGALS3 (AAH53667.1, 1 a.a. ~ 250 a.a) full-length human protein.
  • Sequence:
  • MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • LGALS3 MaxPab polyclonal antibody. Western Blot analysis of LGALS3 expression in human spleen.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • LGALS3 MaxPab polyclonal antibody. Western Blot analysis of LGALS3 expression in Hela S3 NE.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of LGALS3 expression in transfected 293T cell line (H00003958-T01) by LGALS3 MaxPab polyclonal antibody.

    Lane 1: LGALS3 transfected lysate(27.5 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3958
  • Gene Name:
  • LGALS3
  • Gene Alias:
  • CBP35,GAL3,GALBP,GALIG,LGALS2,MAC2
  • Gene Description:
  • lectin, galactoside-binding, soluble, 3
  • Other Designations:
  • IgE-binding protein,MAC-2 antigen,carbohydrate-binding protein 35,galactose-specific lectin 3,galectin 3,galectin-3 internal,laminin-binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook