Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Disease

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LGALS3 polyclonal antibody (A01)

  • Catalog # : H00003958-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant LGALS3.
  • Immunogen:
  • LGALS3 (AAH01120, 1 a.a. ~ 250 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003958-A01
    Western Blot detection against Immunogen (53.61 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3958
  • Gene Name:
  • LGALS3
  • Gene Alias:
  • CBP35,GAL3,GALBP,GALIG,LGALS2,MAC2
  • Gene Description:
  • lectin, galactoside-binding, soluble, 3
  • Other Designations:
  • IgE-binding protein,MAC-2 antigen,carbohydrate-binding protein 35,galactose-specific lectin 3,galectin 3,galectin-3 internal,laminin-binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook