LDHB monoclonal antibody (M01), clone 2H6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant LDHB.
Immunogen
LDHB (AAH02362.1, 1 a.a. ~ 334 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSDINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (62.48 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LDHB monoclonal antibody (M01), clone 2H6 Western Blot analysis of LDHB expression in Hela ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to LDHB on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LDHB is approximately 1ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to LDHB on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — LDHB
Entrez GeneID
3945GeneBank Accession#
BC002362Protein Accession#
AAH02362.1Gene Name
LDHB
Gene Alias
LDH-H, TRG-5
Gene Description
lactate dehydrogenase B
Omim ID
150100Gene Ontology
HyperlinkOther Designations
L-lactate dehydrogenase B|OTTHUMP00000165228|OTTHUMP00000165229
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Aberrant accumulation of TMEM43 accompanied by perturbed transmural gene expression in arrhythmogenic cardiomyopathy.
Haruki Shinomiya, Hisakazu Kato, Yuki Kuramoto, Nozomi Watanabe, Toshihiro Tsuruda, Tadaaki Arimura, Yohei Miyashita, Yoshiki Miyasaka, Tomoji Mashimo, Ayako Takuwa, Daisuke Motooka, Daisuke Okuzaki, Ken Matsuoka, Osamu Tsukamoto, Hideyuki Hakui, Noriaki Yamada, Jong-Kook Lee, Hidetaka Kioka, Masafumi Kitakaze, Seiji Takashima, Yasushi Sakata, Yoshihiro Asano.
FASEB Journal 2021 Nov; 35(11):e21994.
Application:WB-Ce, Rat, Neonatal rat cardiomyocytes.
-
Heterogeneity of Metabolic Vulnerability in Imatinib -Resistant Gastrointestinal Stromal Tumor.
Wen-Kuan Huang, Jiwei Gao, Ziqing Chen, Hao Shi, Juan Yuan, Huanhuan L Cui, Chun-Nan Yeh, Robert Bränström, Catharina Larsson, Shuijie Li, Weng-Onn Lui.
Cells 2020 May; 9(6):E1333.
Application:WB-Ce, Human, GIST 48 cells, GIST 882 cells, GIST T1 cells.
-
Membrane Type 1-Matrix Metalloproteinase/Akt Signaling Axis Modulates TNF-α-Induced Procoagulant Activity and Apoptosis in Endothelial Cells.
Ohkawara H, Ishibashi T, Sugimoto K, Ikeda K, Ogawa K, Takeishi Y.
PLoS One 2014 Aug; 9(8):e105697.
Application:WB-Ce, Human, Endothelial Cells.
-
Pilot application of iTRAQ to the retinal disease Macular Telangiectasia.
Len AC, Powner MB, Zhu L, Hageman GS, Song X, Fruttiger M, Gillies MC.
Journal of Proteome Research 2012 Feb; 11(2):537.
Application:IHC-P, Human, Eye.
-
Quantitative proteomics analysis reveals BAG3 as a potential target to suppress severe acute respiratory syndrome coronavirus replication.
Zhang L, Zhang ZP, Zhang XE, Lin FS, Ge F.
Journal of Virology 2010 Jun; 84(12):6050.
Application:WB, Hamster, BHK-21, SARS-CoV replicon cells.
-
Aberrant accumulation of TMEM43 accompanied by perturbed transmural gene expression in arrhythmogenic cardiomyopathy.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com