LDHA MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
LDHA MaxPab rabbit polyclonal antibody. Western Blot analysis of LDHA expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of LDHA expression in transfected 293T cell line (H00003939-T01) by LDHA MaxPab polyclonal antibody.
Lane 1: LDHA transfected lysate(36.70 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of LDHA transfected lysate using anti-LDHA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with LDHA MaxPab mouse polyclonal antibody (B01) (H00003939-B01).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human LDHA protein.
Immunogen
LDHA (NP_005557.1, 1 a.a. ~ 332 a.a) full-length human protein.
Sequence
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
LDHA MaxPab rabbit polyclonal antibody. Western Blot analysis of LDHA expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of LDHA expression in transfected 293T cell line (H00003939-T01) by LDHA MaxPab polyclonal antibody.
Lane 1: LDHA transfected lysate(36.70 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of LDHA transfected lysate using anti-LDHA MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with LDHA MaxPab mouse polyclonal antibody (B01) (H00003939-B01). -
Gene Info — LDHA
Entrez GeneID
3939GeneBank Accession#
NM_005566.1Protein Accession#
NP_005557.1Gene Name
LDHA
Gene Alias
LDH-M, LDH1, PIG19
Gene Description
lactate dehydrogenase A
Omim ID
150000Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene. [provided by RefSeq
Other Designations
L-lactate dehydrogenase A|proliferation-inducing gene 19
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
TOM70 Sustains Cell Bioenergetics by Promoting IP3R3-Mediated ER to Mitochondria Ca2+ Transfer.
Filadi R, Leal NS, Schreiner B, Rossi A, Dentoni G, Pinho CM, Wiehager B, Cieri D, Cali T, Pizzo P, Ankarcrona M.
Current Biology : CB 2018 Feb; 28(3):369.
Application：IF, Human, HeLa cells.
-
TOM70 Sustains Cell Bioenergetics by Promoting IP3R3-Mediated ER to Mitochondria Ca2+ Transfer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com