Product Browser

Last updated: 2017/1/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LCN1 (Human) Recombinant Protein (P01)

  • Catalog # : H00003933-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LCN1 full-length ORF ( NP_002288.1, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKPLLLAVSLGLIAALQAHHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 45.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003933-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3933
  • Gene Name:
  • LCN1
  • Gene Alias:
  • MGC71975,PMFA,TP,VEGP
  • Gene Description:
  • lipocalin 1 (tear prealbumin)
  • Gene Summary:
  • The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022539,OTTHUMP00000022540,Von Ebner gland protein,lipocalin 1,lipocalin 1 (protein migrating faster than albumin, tear prealbumin),lipocalin 1-like 2,tear lipocalin
  • RSS
  • YouTube
  • Linkedin
  • Facebook