Product Browser

Last updated: 2017/11/12
  • Related Product Showcase
  • By Research Area

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LCN1 polyclonal antibody (A01)

  • Catalog # : H00003933-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LCN1.
  • Immunogen:
  • LCN1 (NP_002288, 24 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGRCQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYCE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003933-A01
    Western Blot detection against Immunogen (36.78 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • LCN1 polyclonal antibody (A01), Lot # 060814QCS1. Western Blot analysis of LCN1 expression in 293.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • LCN1 polyclonal antibody (A01), Lot # 051219JCO1 Western Blot analysis of LCN1 expression in Jurkat ( Cat # L017V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3933
  • Gene Name:
  • LCN1
  • Gene Alias:
  • MGC71975,PMFA,TP,VEGP
  • Gene Description:
  • lipocalin 1 (tear prealbumin)
  • Gene Summary:
  • The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000022539,OTTHUMP00000022540,Von Ebner gland protein,lipocalin 1,lipocalin 1 (protein migrating faster than albumin, tear prealbumin),lipocalin 1-like 2,tear lipocalin
  • RSS
  • YouTube
  • Linkedin
  • Facebook