Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

STMN1 (Human) Recombinant Protein (P01)

  • Catalog # : H00003925-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human STMN1 full-length ORF ( NP_005554.1, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 43.7
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003925-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3925
  • Gene Name:
  • STMN1
  • Gene Alias:
  • LAP18,Lag,OP18,PP17,PP19,PR22,SMN
  • Gene Description:
  • stathmin 1/oncoprotein 18
  • Gene Summary:
  • This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000008527,OTTHUMP00000008528,OTTHUMP00000008530,leukemia-associated phosphoprotein p18,metablastin,oncoprotein 18,phosphoprotein 19,prosolin,stathmin 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook