Product Browser

Last updated: 2016/12/11
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

STMN1 monoclonal antibody (M01A), clone 3A9

  • Catalog # : H00003925-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant STMN1.
  • Immunogen:
  • STMN1 (AAH14353, 40 a.a. ~ 149 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • PKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgM Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003925-M01A
    Western Blot detection against Immunogen (37.73 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of STMN1 expression in transfected 293T cell line by STMN1 monoclonal antibody (M01A), clone 3A9.

    Lane 1: STMN1 transfected lysate (Predicted MW: 17.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of STMN1 transfected lysate using anti-STMN1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with STMN1 MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3925
  • Gene Name:
  • STMN1
  • Gene Alias:
  • LAP18,Lag,OP18,PP17,PP19,PR22,SMN
  • Gene Description:
  • stathmin 1/oncoprotein 18
  • Gene Summary:
  • This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000008527,OTTHUMP00000008528,OTTHUMP00000008530,leukemia-associated phosphoprotein p18,metablastin,oncoprotein 18,phosphoprotein 19,prosolin,stathmin 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook