STMN1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
STMN1 MaxPab rabbit polyclonal antibody. Western Blot analysis of STMN1 expression in mouse spleen.
Western Blot (Transfected lysate)
Western Blot analysis of STMN1 expression in transfected 293T cell line (H00003925-T01) by STMN1 MaxPab polyclonal antibody.
Lane 1: STMN1 transfected lysate(17.30 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human STMN1 protein.
Immunogen
STMN1 (NP_005554.1, 1 a.a. ~ 149 a.a) full-length human protein.
Sequence
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
STMN1 MaxPab rabbit polyclonal antibody. Western Blot analysis of STMN1 expression in mouse spleen.Western Blot (Transfected lysate)
Western Blot analysis of STMN1 expression in transfected 293T cell line (H00003925-T01) by STMN1 MaxPab polyclonal antibody.
Lane 1: STMN1 transfected lysate(17.30 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — STMN1
Entrez GeneID
3925GeneBank Accession#
NM_005563Protein Accession#
NP_005554.1Gene Name
STMN1
Gene Alias
LAP18, Lag, OP18, PP17, PP19, PR22, SMN
Gene Description
stathmin 1/oncoprotein 18
Omim ID
151442Gene Ontology
HyperlinkGene Summary
This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000008527|OTTHUMP00000008528|OTTHUMP00000008530|leukemia-associated phosphoprotein p18|metablastin|oncoprotein 18|phosphoprotein 19|prosolin|stathmin 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com