Product Browser

Last updated: 2017/5/28
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

STMN1 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00003925-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human STMN1 protein.
  • Immunogen:
  • STMN1 (NP_005554.1, 1 a.a. ~ 149 a.a) full-length human protein.
  • Sequence:
  • MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • STMN1 MaxPab rabbit polyclonal antibody. Western Blot analysis of STMN1 expression in mouse spleen.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of STMN1 expression in transfected 293T cell line (H00003925-T01) by STMN1 MaxPab polyclonal antibody.

    Lane 1: STMN1 transfected lysate(17.30 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 3925
  • Gene Name:
  • STMN1
  • Gene Alias:
  • LAP18,Lag,OP18,PP17,PP19,PR22,SMN
  • Gene Description:
  • stathmin 1/oncoprotein 18
  • Gene Summary:
  • This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000008527,OTTHUMP00000008528,OTTHUMP00000008530,leukemia-associated phosphoprotein p18,metablastin,oncoprotein 18,phosphoprotein 19,prosolin,stathmin 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook