LAMP2 monoclonal antibody (M01), clone 2G10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of LAMP2 expression in transfected 293T cell line by LAMP2 monoclonal antibody (M01), clone 2G10.
Lane 1: LAMP2 transfected lysate (Predicted MW: 45 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LAMP2 is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LAMP2.
Immunogen
LAMP2 (NP_054701, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LAMP2 expression in transfected 293T cell line by LAMP2 monoclonal antibody (M01), clone 2G10.
Lane 1: LAMP2 transfected lysate (Predicted MW: 45 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LAMP2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — LAMP2
Entrez GeneID
3920GeneBank Accession#
NM_013995Protein Accession#
NP_054701Gene Name
LAMP2
Gene Alias
CD107b, LAMPB, LGP110
Gene Description
lysosomal-associated membrane protein 2
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. [provided by RefSeq
Other Designations
OTTHUMP00000023943|OTTHUMP00000023944|lysosome-associated membrane protein 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com