Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LAMP2 polyclonal antibody (A01)

  • Catalog # : H00003920-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LAMP2.
  • Immunogen:
  • LAMP2 (NP_054701, 30 a.a. ~ 127 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003920-A01
    Western Blot detection against Immunogen (36.89 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3920
  • Gene Name:
  • LAMP2
  • Gene Alias:
  • CD107b,LAMPB,LGP110
  • Gene Description:
  • lysosomal-associated membrane protein 2
  • Gene Summary:
  • The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000023943,OTTHUMP00000023944,lysosome-associated membrane protein 2
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook