LAMC1 monoclonal antibody (M03), clone M1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LAMC1 is approximately 0.03ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between LAMA5 and LAMC1. HeLa cells were stained with anti-LAMA5 rabbit purified polyclonal 1:1200 and anti-LAMC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (29.92 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant LAMC1.
Immunogen
LAMC1 (AAH15586, 1 a.a. ~ 38 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (29.92 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LAMC1 is approximately 0.03ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between LAMA5 and LAMC1. HeLa cells were stained with anti-LAMA5 rabbit purified polyclonal 1:1200 and anti-LAMC1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — LAMC1
Entrez GeneID
3915GeneBank Accession#
BC015586Protein Accession#
AAH15586Gene Name
LAMC1
Gene Alias
LAMB2, MGC87297
Gene Description
laminin, gamma 1 (formerly LAMB2)
Gene Ontology
HyperlinkGene Summary
Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the gamma chain isoform laminin, gamma 1. The gamma 1 chain, formerly thought to be a beta chain, contains structural domains similar to beta chains, however, lacks the short alpha region separating domains I and II. The structural organization of this gene also suggested that it had diverged considerably from the beta chain genes. Embryos of transgenic mice in which both alleles of the gamma 1 chain gene were inactivated by homologous recombination, lacked basement membranes, indicating that laminin, gamma 1 chain is necessary for laminin heterotrimer assembly. It has been inferred by analogy with the strikingly similar 3' UTR sequence in mouse laminin gamma 1 cDNA, that multiple polyadenylation sites are utilized in human to generate the 2 different sized mRNAs (5.5 and 7.5 kb) seen on Northern analysis. [provided by RefSeq
Other Designations
OTTHUMP00000033450|formerly LAMB2|laminin, gamma 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com