Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LAMB3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003914-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LAMB3 partial ORF ( NP_000219, 1064 a.a. - 1171 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYYATC
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.62
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003914-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3914
  • Gene Name:
  • LAMB3
  • Gene Alias:
  • BM600-125KDA,FLJ99565,LAM5,LAMNB1
  • Gene Description:
  • laminin, beta 3
  • Gene Summary:
  • The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000034555,OTTHUMP00000034640,kalinin B1 chain,kalinin-140kDa,laminin B1k chain,laminin S B3 chain,laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD)),nicein-125kDa
  • RSS
  • YouTube
  • Linkedin
  • Facebook