LAMB3 monoclonal antibody (M01), clone 2G10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LAMB3.
Immunogen
LAMB3 (NP_000219, 1064 a.a. ~ 1171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYYATC
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (86)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LAMB3 monoclonal antibody (M01), clone 2G10 Western Blot analysis of LAMB3 expression in A-431 ( Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LAMB3 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to LAMB3 on A-431 cell. [antibody concentration 10 ug/ml] -
Gene Info — LAMB3
Entrez GeneID
3914GeneBank Accession#
NM_000228Protein Accession#
NP_000219Gene Name
LAMB3
Gene Alias
BM600-125KDA, FLJ99565, LAM5, LAMNB1
Gene Description
laminin, beta 3
Gene Ontology
HyperlinkGene Summary
The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000034555|OTTHUMP00000034640|kalinin B1 chain|kalinin-140kDa|laminin B1k chain|laminin S B3 chain|laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD))|nicein-125kDa
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Clinical significance of LAMB3 and COL7A1 mRNA in esophageal squamous cell carcinoma.
Kita Y, Mimori K, Tanaka F, Matsumoto T, Haraguchi N, Ishikawa K, Matsuzaki S, Fukuyoshi Y, Inoue H, Natsugoe S, Aikou T, Mori M.
European Journal of Surgical Oncology 2008 Mar; 35(1):52.
Application:IHC-P, WB-Ti, Human, Human esophageal cancer.
-
Clinical significance of LAMB3 and COL7A1 mRNA in esophageal squamous cell carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com