Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LAMB3 polyclonal antibody (A01)

  • Catalog # : H00003914-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant LAMB3.
  • Immunogen:
  • LAMB3 (NP_000219, 1064 a.a. ~ 1171 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • AEGASEQALSAQEGFERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKDMELELLRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYYATC
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003914-A01
    Western Blot detection against Immunogen (37.99 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3914
  • Gene Name:
  • LAMB3
  • Gene Alias:
  • BM600-125KDA,FLJ99565,LAM5,LAMNB1
  • Gene Description:
  • laminin, beta 3
  • Gene Summary:
  • The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000034555,OTTHUMP00000034640,kalinin B1 chain,kalinin-140kDa,laminin B1k chain,laminin S B3 chain,laminin, beta 3 (nicein (125kD), kalinin (140kD), BM600 (125kD)),nicein-125kDa
  • RSS
  • YouTube
  • Linkedin
  • Facebook