LAMA5 monoclonal antibody (M01), clone 2F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LAMA5.
Immunogen
LAMA5 (AAH03355.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGVSLRDKKVHWVYQLGEAGPAVLSIDEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGGYPSTFTPPPLLRFP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of LAMA5 expression in transfected 293T cell line by LAMA5 monoclonal antibody (M01), clone 2F7.
Lane 1: LAMA5 transfected lysate(74 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged LAMA5 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — LAMA5
Entrez GeneID
3911GeneBank Accession#
BC003355Protein Accession#
AAH03355.1Gene Name
LAMA5
Gene Alias
KIAA1907
Gene Description
laminin, alpha 5
Omim ID
601033Gene Ontology
HyperlinkGene Summary
Components of the extracellular matrix exert myriad effects on tissues throughout the body. In particular, the laminins, a family of heterotrimeric extracellular glycoproteins, affect tissue development and integrity in such diverse organs as the kidney, lung, skin, and nervous system. It is thought that laminins mediate the attachment, migration, and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Laminins function as heterotrimeric complexes of alpha, beta, and gamma chains, with each chain type representing a different subfamily of proteins. The protein encoded by this gene belongs to the alpha subfamily of laminin chains and is a major component of basement membranes. Two transcript variants encoding different isoforms have been found for this gene, but the full-length nature of one of them has not been determined. [provided by RefSeq
Other Designations
laminin alpha 5|laminin alpha-5 chain
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Photoreceptor laminin drives differentiation of human pluripotent stem cells to photoreceptor progenitors that partially restore retina function.
Hwee Goon Tay, Helder Andre, Vicki Chrysostomou, Swarnaseetha Adusumalli, Jing Guo, Xiaoyuan Ren, Wei Sheng Tan, Jia En Tor, Aida Moreno-Moral, Flavia Plastino, Hammurabi Bartuma, Zuhua Cai, Sai Bo Bo Tun, Veluchamy Amutha Barathi, Gavin Tan Siew Wei, Gianluca Grenci, Li Yen Chong, Arne Holmgren, Anders Kvanta, Crowston Jonathan Guy, Enrico Petretto, Karl Tryggvason.
Molecular Therapy 2023 Jan; S1525-0016(22):00716-X.
Application:WB-Ce, Human, HKE293 cells.
-
Genome-wide Runx2 occupancy in prostate cancer cells suggests a role in regulating secretion.
Little GH, Noushmehr H, Baniwal SK, Berman BP, Coetzee GA, Frenkel B.
Nucleic Acids Research 2011 Dec; 40(8):3538.
Application:WB, Human, C4-2B/Rx2dox.
-
Melanoma cells produce multiple laminin isoforms and strongly migrate on ?5 laminin(s) via several integrin receptors.
Oikawa Y, Hansson J, Sasaki T, Rousselle P, Domogatskaya A, Rodin S, Tryggvason K, Patarroyo M.
Experimental Cell Research 2011 May; 317(8):1119.
Application:IHC, Human, Melanoma tumor.
-
Proteomics Analysis of Nasopharyngeal Carcinoma Cell Secretome Using a Hollow Fiber Culture System and Mass Spectrometry.
Wu HY, Chang YH, Chang YC, Liao PC.
Journal of Proteome Research 2008 Nov; 8(1):380.
Application:WB, Human, Nasopharyngeal carcinoma cell line NPC-TW04.
-
Proteomic analysis of platelet a-granules using mass spectrometry.
Maynard DM, Heijnen HF, Horne MK, White JG, Gahl WA.
Journal of Thrombosis and Haemostasis 2007 Jul; 5(9):1945.
Application:IEM, Human, Platelets from healthy donors.
-
Photoreceptor laminin drives differentiation of human pluripotent stem cells to photoreceptor progenitors that partially restore retina function.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com