Product Browser

Last updated: 2017/4/30

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LAMA3 (Human) Recombinant Protein (Q01)

  • Catalog # : H00003909-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LAMA3 partial ORF ( NP_000218, 29 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SSQQQRVPFLQPPGQSQLQASYVEFRPSQGCSPGYYRDHKGLYTGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHGSCRACPCPHTNSFATGCV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00003909-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 3909
  • Gene Name:
  • LAMA3
  • Gene Alias:
  • BM600,E170,LAMNA,LOCS,lama3a
  • Gene Description:
  • laminin, alpha 3
  • Gene Summary:
  • Laminins are basement membrane components thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. The protein encoded by this gene is the alpha-3 subunit of laminin 5, which is a complex glycoprotein composed of three subunits (alpha, beta, and gamma). Laminin 5 is thought to be involved in cell adhesion, signal transduction and differentiation of keratinocytes. Mutations in this gene have been identified as the cause of Herlitz type junctional epidermolysis bullosa. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • BM600 150kD subunit,epiligrin 170 kda subunit,epiligrin alpha 3 subunit,kalinin 165kD subunit,laminin alpha 3 subunit,laminin, alpha 3 (nicein (150kD), kalinin (165kD), BM600 (150kD), epilegrin),laminin-5 alpha 3 chain,nicein 150kD subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook